PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00022378001
Common NameGSBRNA2T00022378001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 599aa    MW: 65582.5 Da    PI: 5.3698
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00022378001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.76e-14163223262
                          XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
               bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                           e k+  r+++NRe+A+ sRqRKk ++eeLeekvk+L +  ++L  +++    e a+l+++
  GSBRNA2T00022378001 163 DEKKKRARLIRNRESAQLSRQRKKHYVEELEEKVKSLHSCITDLNGKISYFMAENATLRQQ 223
                          6779999**************************************9999999999999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.7E-15161226IPR004827Basic-leucine zipper domain
PfamPF001702.4E-12163224IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.128164224IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.31E-12166224No hitNo description
Gene3DG3DSA:1.20.5.1701.5E-16166224No hitNo description
CDDcd147041.16E-19168218No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 599 aa     Download sequence    Send to blast
MAESITEEPP PPEFDPISTP PFAQFHNPSS DQTPIGELMS DLGFPIDADF ELTFDGMEDL  60
YLPAEDETFL LPDNASNQEQ FGDFTPESDD ERTLDQSTPL SSQGSDNCGS DVSEAVDQKV  120
KVEEASATKR KKEDASDESR SSKFMRSGEE SAVVTGEEEE EEDEKKKRAR LIRNRESAQL  180
SRQRKKHYVE ELEEKVKSLH SCITDLNGKI SYFMAENATL RQQLGPPPPM GMYPPMAYPW  240
MHCPPYMVKQ QGGGQVPLIP IPRLKPQNPV KAKSKKSEAR TKKVASISFL GLVFCLFLFG  300
ALAPVVNVNY GGISNGVFYG SYRSNYVTDQ VYNQHRNRVL DTSRSNERDS ATESSVPPGN  360
GSEPLVASLF VPRNDKLVKI DGNLIINSIL ASEKALASES NERKADGDMA KHLVRTKAEK  420
QKALSSGSAD TLKDSIKTKA ASGEMQQWFR EGVAGPMFSS GMCTEVFQFD VSSTSGAIIP  480
ASAATNVSSE HSKNATDRQR RKNRRTLRGL AIPLPGSDFN FTKEHQRNSS SKEIKAASSM  540
VVSVLVDPRE GGDGDIDGMI GGPKSLSRVF VVVLQDSAKY VTYSCVLPRP GAPHLVTT*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1498504QRRKNRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.148530.0seed
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1362950.0AY136295.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
GenBankBT0004080.0BT000408.1 Arabidopsis thaliana putative TGACG-sequence-specific bZIP DNA-binding protein (At2g40950) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013687770.10.0PREDICTED: bZIP transcription factor 17-like
SwissprotO222080.0BZP17_ARATH; bZIP transcription factor 17
TrEMBLA0A078J4Q60.0A0A078J4Q6_BRANA; BnaC04g56770D protein
STRINGBra016959.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88812737
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40950.10.0bZIP family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]